Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kinesin 5C Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen Kinesin 5C
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Applications Western Blot, Immunoprecipitation
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123554
View Documents
Novus Biologicals
NBP30932625UL
25 μg
Each for $106.19
Add to cart
 
NB123553
View Documents
Novus Biologicals
NBP309326100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

Kinesin 5C Polyclonal antibody specifically detects Kinesin 5C in Human, Mouse samples. It is validated for Western Blot, Immunoprecipitation
Specifications

Specifications

Kinesin 5C
Western Blot, Immunoprecipitation
Purified
RUO
Human, Mouse
heavy chain, neuron-specific, KIF 5C, kinesin family member 5C, Kinesin heavy chain neuron-specific 2, MGC111478, NKHC, NKHC2NKHC-2
The immunogen is a synthetic peptide directed towards the N terminal region of human Kinesin 5C (NP_004513). Peptide sequence ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunoprecipitation
Unconjugated
Rabbit
Cell Biology, Cellular Markers
PBS buffer, 2% sucrose
3800
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit