KIR2DL5B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309480100UL

Catalog No. NB123861

Description

KIR2DL5B Polyclonal specifically detects KIR2DL5B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KIR2DL5B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 5B, CD158 antigen-like family member F2, CD158F, CD158F2, CD158f2 antigen, killer cell immunoglobulin-like receptor 2DL5B, Killer cell immunoglobulin-like receptor 2DLX, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, KIR2DL5.2, KIR2DL5.3, KIR2DL5.4, KIR2DL5killer cell Ig-like receptor, KIR2DLX
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B (NP_001018091). Peptide sequence DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 553128
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.