Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIR2DL5B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP309480100UL

 View more versions of this product

Catalog No. NB123861


Add to cart

Description

Description

KIR2DL5B Polyclonal antibody specifically detects KIR2DL5B in Human samples. It is validated for Western Blot
Specifications

Specifications

KIR2DL5B
Unconjugated
PBS buffer, 2% sucrose
5B, CD158 antigen-like family member F2, CD158F, CD158F2, CD158f2 antigen, killer cell immunoglobulin-like receptor 2DL5B, Killer cell immunoglobulin-like receptor 2DLX, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, KIR2DL5.2, KIR2DL5.3, KIR2DL5.4, KIR2DL5killer cell Ig-like receptor, KIR2DLX
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B (NP_001018091). Peptide sequence DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
553128
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit