Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIR2DS4/CD158i Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89


Antigen KIR2DS4/CD158i
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart
View Documents
Novus Biologicals
100 μg
Each for $352.89
Add to cart


KIR2DS4/CD158i Polyclonal antibody specifically detects KIR2DS4/CD158i in Human samples. It is validated for Western Blot


Western Blot
PBS buffer, 2% sucrose
Affinity purified
Western Blot 1.0 ug/ml
CD158 antigen-like family member I, CD158I, CD158i antigen, cl-39, killer cell immunoglobulin-like receptor 2DS4, killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail4,nkat8, killer inhibitory receptor 4-1-2, KIR antigen 2DS4, KKA3KIR1D, MGC120019, MGC125315, MGC125317, MHC class I NK cell receptor, natural killer cell inhibitory receptor, Natural killer-associated transcript 8, NKAT-8, NKAT8KIR412, P58 natural killer cell receptor clones CL-39/CL-17, p58 NK receptor CL-39/CL-17
The immunogen is a synthetic peptide directed towards the N terminal region of human KIR2DS4/CD158i (NP_001268900.1). Peptide sequence FLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHRE
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit