Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIR3DL2/CD158k Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309425100UL
Description
KIR3DL2/CD158k Polyclonal specifically detects KIR3DL2/CD158k in Human samples. It is validated for Western Blot.Specifications
KIR3DL2/CD158k | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
killer cell immunoglobulin-like receptor 3DL2, CD158K, killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2, NKAT4, NKAT-4, NKAT4B, p140 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR3DL2/CD158k (NP_006728). Peptide sequence LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
3812 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction