Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIR5.1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | KIR5.1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125623
|
Novus Biologicals
NBP310361100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
KIR5.1 Polyclonal specifically detects KIR5.1 in Rat samples. It is validated for Western Blot.Specifications
| KIR5.1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| BIR9, Inward rectifier K(+) channel Kir5.1, inward rectifier K+ channel KIR5.1, inward rectifier potassium channel 16, KIR5.1, MGC33717, Potassium channel, inwardly rectifying subfamily J member 16, potassium inwardly-rectifying channel, subfamily J, member 16 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Rat KIR5.1 (NP_445766). Peptide sequence VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 3773 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title