Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15477120UL

 View more versions of this product

Catalog No. NBP1547720


Add to cart

Description

Description

KLC3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

KLC3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
KLC3
Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3 (NP_8031360). Peptide sequence MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL.
55 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 0.2-1 ug/ml
Q6P597
kinesin light chain 3, KLC2, KLC2-like, KLC2Lkinesin light chain 2, KLCt, KNS2B
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
147700
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit