Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KLC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154771
|
Novus Biologicals
NBP154771 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KLC3 Polyclonal specifically detects KLC3 in Human samples. It is validated for Western Blot.Specifications
| KLC3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| kinesin light chain 3, KLC2, KLC2-like, KLC2Lkinesin light chain 2, KLCt, KNS2B | |
| KLC3 | |
| IgG | |
| Affinity Purified | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6P597 | |
| 147700 | |
| Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3 (NP_8031360). Peptide sequence MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title