Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLF11 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310447100UL
Description
KLF11 Polyclonal specifically detects KLF11 in Mouse samples. It is validated for Western Blot.Specifications
| KLF11 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| FKLFFKLF1, Krueppel-like factor 11, Kruppel-like factor 11, MODY7TGFB-inducible early growth response protein 2, TIEG-2, TIEG2TGFB inducible early growth response 2, Tieg3, Transforming growth factor-beta-inducible early growth response protein 2 | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_848134). Peptide sequence PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH | |
| 100 μg | |
| Cell Cycle and Replication, Transcription Factors and Regulators | |
| 8462 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction