Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLF12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18001020UL

 View more versions of this product

Catalog No. NBP18001020


Add to cart

Description

Description

KLF12 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

KLF12
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
KLF12
Synthetic peptide directed towards the N terminal of human KLF12. Peptide sequence MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP.
28 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
EAW80528
AP-2rep, AP-2rep transcription factor, AP2REPAP-2 repressor, HSPC122, KLF12 zinc finger transcriptional repressor, Krueppel-like factor 12, Kruppel-like factor 12, Transcriptional repressor AP-2rep
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
11278
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit