KLF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182403

Catalog No. NBP182403

Description

KLF3 Polyclonal specifically detects KLF3 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: KLF3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001099212
• Gene Symbols: KLF3
• Immunogen: Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 51274
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.