Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLF3 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | KLF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18240320
|
Novus Biologicals
NBP18240320UL |
20 μL |
Each for $152.22
|
|
NBP182403
|
Novus Biologicals
NBP182403 |
100 μL |
Each for $436.00
|
|
Description
KLF3 Polyclonal specifically detects KLF3 in Rat samples. It is validated for Western Blot.Specifications
| KLF3 | |
| Polyclonal | |
| Rabbit | |
| NP_001099212 | |
| 51274 | |
| Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2 | |
| KLF3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title