Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00
Specifications
| Antigen | KLHDC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15541920
|
Novus Biologicals
NBP15541920UL |
20 μL |
Each of 1 for $206.00
|
|
|||||
Description
KLHDC2 Polyclonal specifically detects KLHDC2 in Human samples. It is validated for Western Blot.Specifications
| KLHDC2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HCA33, HCLP-1Host cell factor-like protein 1, Hepatocellular carcinoma-associated antigen 33, Host cell factor homolog LCP, kelch domain containing 2, kelch domain-containing protein 2, LCP | |
| KLHDC2 | |
| IgG | |
| Affinity Purified | |
| 46 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y2U9 | |
| 23588 | |
| Synthetic peptides corresponding to KLHDC2(kelch domain containing 2) The peptide sequence was selected from the N terminal of KLHDC2. Peptide sequence VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title