Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHDC5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19142220UL

 View more versions of this product

Catalog No. NBP19142220


Add to cart

Description

Description

KLHDC5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

KLHDC5
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
KLHDC5
Synthetic peptide directed towards the middle region of human KLHDC5. Peptide sequence IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC.
57 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_065833
Ctb9, kelch domain containing 5, kelch domain-containing protein 5, KIAA1340, MGC131714
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
57542
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit