Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC8B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170592
Description
KLHDC8B Polyclonal specifically detects KLHDC8B in Human samples. It is validated for Western Blot.Specifications
| KLHDC8B | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| FLJ11302, FP17659, kelch domain containing 8B | |
| Rabbit | |
| 38 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KLHDC8B | |
| Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the middle region of KLHDC8B. Peptide sequence AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM. | |
| Affinity Purified | |
| RUO | |
| 200942 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title