Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC8B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KLHDC8B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170592
|
Novus Biologicals
NBP170592 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KLHDC8B Polyclonal specifically detects KLHDC8B in Human samples. It is validated for Western Blot.Specifications
| KLHDC8B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 200942 | |
| Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the middle region of KLHDC8B. Peptide sequence AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ11302, FP17659, kelch domain containing 8B | |
| KLHDC8B | |
| IgG | |
| Affinity Purified | |
| 38 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title