Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHDC8B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen KLHDC8B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170592
View Documents
Novus Biologicals
NBP170592
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

KLHDC8B Polyclonal specifically detects KLHDC8B in Human samples. It is validated for Western Blot.
Specifications

Specifications

KLHDC8B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
200942
Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the middle region of KLHDC8B. Peptide sequence AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
FLJ11302, FP17659, kelch domain containing 8B
KLHDC8B
IgG
Affinity Purified
38 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit