Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHDC9 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17947120UL

 View more versions of this product

Catalog No. NBP1794720


Add to cart

Description

Description

KLHDC9 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

KLHDC9
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
KLHDC9
The immunogen for this antibody is Klhdc9. Peptide sequence HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR.
39 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
NP_001028211
KARCA1Kelch/ankyrin repeat-containing cyclin A1-interacting protein, kelch domain containing 9, kelch domain-containing protein 9, MGC33338, RP11-544M22.9
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
126823
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit