Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHL13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18004720UL

 View more versions of this product

Catalog No. NBP18004720


Add to cart

Description

Description

KLHL13 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

KLHL13
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
KLHL13
Synthetic peptide directed towards the N terminal of human KLHL13. Peptide sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS.
74 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_277030
BTB and kelch domain containing 2, BTB and kelch domain-containing protein 2, kelch-like 13 (Drosophila), kelch-like protein 13, KIAA1309, MGC74791
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
90293
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit