Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | KLHL14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18004820
|
Novus Biologicals
NBP18004820UL |
20 μL |
Each for $152.22
|
|
NBP180048
|
Novus Biologicals
NBP180048 |
100 μL |
Each for $436.00
|
|
Description
KLHL14 Polyclonal specifically detects KLHL14 in Human samples. It is validated for Western Blot.Specifications
| KLHL14 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_065856 | |
| 57565 | |
| Synthetic peptide directed towards the N terminal of human KLHL14. Peptide sequence MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| kelch-like 14 (Drosophila), kelch-like protein 14, KIAA1384, printor | |
| KLHL14 | |
| IgG | |
| Protein A purified | |
| 71 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title