Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHL35 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179550

 View more versions of this product

Catalog No. NBP179550

Add to cart



KLHL35 Polyclonal antibody specifically detects KLHL35 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


Affinity Purified
100 ul
Human,Mouse,Rat,Bovine,Canine,Equine,Guinea Pig,Rabbit
Western Blot
Western Blot 1:1000
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ33790, kelch-like 35 (Drosophila)
Synthetic peptide directed towards the N terminal of human FLJ33790The immunogen for this antibody is FLJ33790. Peptide sequence RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR.
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 85%; Canine: 85%.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit