Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | KLHL7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15546220
|
Novus Biologicals
NBP15546220UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP155462
|
Novus Biologicals
NBP155462 |
100 μL |
Each for $482.50
|
|
|||||
Description
KLHL7 Polyclonal specifically detects KLHL7 in Human samples. It is validated for Western Blot.Specifications
| KLHL7 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| kelch (Drosophila)-like 6, kelch/BTB, kelch-like 6, kelch-like 7 (Drosophila), kelch-like protein 7, KLHL6, RP42, SBBI26 | |
| KLHL7 | |
| IgG | |
| 62 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IXQ5-2 | |
| 55975 | |
| Synthetic peptides corresponding to KLHL7(kelch-like 7 (Drosophila)) The peptide sequence was selected from the middle region of KLHL7. Peptide sequence AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title