Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | KLHL9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1550920
|
Novus Biologicals
NBP15509120UL |
20 μL |
Each for $152.22
|
|
NBP155091
|
Novus Biologicals
NBP155091 |
100 μL |
Each for $436.00
|
|
Description
KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.Specifications
| KLHL9 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 | |
| KLHL9 | |
| IgG | |
| Affinity Purified | |
| 69 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9P2J3 | |
| 55958 | |
| Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title