Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLRA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KLRA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159032
|
Novus Biologicals
NBP159032 |
100 μL |
Each for $436.00
|
|
NBP15903220
|
Novus Biologicals
NBP15903220UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
KLRA1 Polyclonal specifically detects KLRA1 in Human samples. It is validated for Western Blot.Specifications
| KLRA1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| killer cell lectin-like receptor subfamily A pseudogene 1, KLRA#, KLRA1, Ly49, Ly-49L, LY49L, MGC126520, MGC126522 | |
| Synthetic peptides corresponding to KLRA1(killer cell lectin-like receptor subfamily A, member 1) The peptide sequence was selected from the N terminal of KLRA1. Peptide sequence NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UNG0 | |
| 10748 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title