Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KOX2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17944920UL
Description
KOX2 Polyclonal specifically detects KOX2 in Human samples. It is validated for Western Blot.Specifications
KOX2 | |
Polyclonal | |
Western Blot 1:1000 | |
EAW85891 | |
ZNF33A | |
The specific Immunogen is proprietary information. Peptide sequence LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KOX2, KOX31, zinc finger protein 11A, zinc finger protein 33A, zinc finger protein KOX31, ZNF11, ZZAPK | |
Rabbit | |
Affinity Purified | |
RUO | |
7581 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title