Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KOX8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KOX8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179392
|
Novus Biologicals
NBP179392 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KOX8 Polyclonal specifically detects KOX8 in Human samples. It is validated for Western Blot.Specifications
| KOX8 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686L10267, FLJ16755, FLJ46310, KOX8, zinc finger protein 15, zinc finger protein 15-like 1 (KOX 8), zinc finger protein 708, zinc finger protein KOX8, ZNF15, ZNF15L1 | |
| ZNF708 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EAW84891 | |
| 7562 | |
| Synthetic peptide directed towards the C terminal of human ZNF708. Peptide sequence ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title