Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KRIT1 Polyclonal Antibody

Supplier: Thermo Scientific PA595383

Catalog No. PIPA595383

$559.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

KRIT1 Polyclonal Antibody for Western Blot

Specifications

Antigen	KRIT1
Classification	Polyclonal
Conjugate	Unconjugated
Gene	KRIT1
Gene Alias	2010007K12Rik; A630036P20Rik; AA432855; AI450393; AI643869; ankyrin repeat-containing protein Krit1; BB155247; BB235701; CAM; Ccm1; Cerebral cavernous malformations 1 protein; cerebral cavernous malformations 1 protein homolog; Krev interaction trapped 1; krev interaction trapped protein 1; KRIT1; KRIT1, ankyrin repeat containing; RGD1305929
Host Species	Rabbit
Purification Method	Affinity Chromatography
Regulatory Status	RUO
Gene ID (Entrez)	362317, 79264, 889
Content And Storage	-20°C
Form	Lyophilized

Applications	Western Blot
Concentration	500 μg/mL
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Gene Accession No.	O00522, Q6S5J6
Gene Symbols	KRIT1
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS).
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Product Suggestions Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

KRIT1 Polyclonal Antibody

Description

Specifications

Product Suggestions

Safety and Handling

Documents

Promotions