KRT222 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170595

Catalog No. NBP170595

Description

KRT222 Polyclonal specifically detects KRT222 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KRT222
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: keratin 222, truncated type I keratin KA21
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 125113
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: KRT222
• Immunogen: Synthetic peptides corresponding to KRT222P(keratin 222 pseudogene) The peptide sequence was selected from the N terminal of KRT222P. Peptide sequence ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Canine: 100%; Bovine: 100%; Mouse: 100%; Human: 100%; Eubacterium siraeum DSM 15702: 90%; Eubacterium siraeum 70/3: 90%;.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG