Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv1.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310293100UL
Description
Kv1.2 Polyclonal specifically detects Kv1.2 in Human samples. It is validated for Western Blot.Specifications
Kv1.2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 3.6.1.27, EC 6.1.1, HBK5, HK4, HUKIV, Kv1.2, MGC50217, MK2, NGK1, potassium channel, potassium voltage-gated channel subfamily A member 2, potassium voltage-gated channel, shaker-related subfamily, member 2, RBK2, Voltage-gated K(+) channel HuKIV, Voltage-gated potassium channel HBK5, voltage-gated potassium channel protein Kv1.2, Voltage-gated potassium channel subunit Kv1.2 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Kv1.2 (NP_004965.1). Peptide sequence AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD | |
100 μg | |
Lipid and Metabolism, Neuroscience, Neurotransmission, Potassium Channels | |
3737 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction