Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv11.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310366100UL
Description
Kv11.1 Polyclonal specifically detects Kv11.1 in Human samples. It is validated for Western Blot.Specifications
Kv11.1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Eag homolog, Eag-related protein 1, ERG, erg1, ERG-1, Ether-a-go-go-related gene potassium channel 1, ether-a-go-go-related potassium channel protein, Ether-a-go-go-related protein 1, H-ERG, HERG1, HERGhERG-1, Kv11.1, LQT2, potassium voltage-gated channel subfamily H member 2, potassium voltage-gated channel, subfamily H (eag-related), member 2, SQT1, Voltage-gated potassium channel subunit Kv11.1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Kv11.1 (NP_742054). Peptide sequence SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG | |
100 μg | |
Neuroscience, Neurotransmission, Potassium Channels | |
3757 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction