Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kv3.3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310356100UL

 View more versions of this product

Catalog No. NB125613

Add to cart



Kv3.3 Polyclonal antibody specifically detects Kv3.3 in Human samples. It is validated for Western Blot, Immunohistochemistry


PBS buffer, 2% sucrose
KSHIIID, KV3.3, potassium voltage-gated channel subfamily C member 3, potassium voltage-gated channel, Shaw-related subfamily, member 3, SCA13, Shaw-related voltage-gated potassium channel protein 3, spinocerebellar ataxia 13, voltage-gated potassium channel protein KV3.3, Voltage-gated potassium channel subunit Kv3.3
The immunogen is a synthetic peptide directed towards the middle region of human Kv3.3 (NP_004968). Peptide sequence YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
100 μg
Neuronal Cell Markers, Neuroscience, Neurotransmission
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit