Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kv6.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180098

 View more versions of this product

Catalog No. NBP180098


Add to cart

Description

Description

Kv6.1 Polyclonal antibody specifically detects Kv6.1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

Kv6.1
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
KCNG1
Synthetic peptide directed towards the N terminal of human KCNG1. Peptide sequence YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA.
Immunogen affinity purified
RUO
Primary
3755
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_002228
KCNG, KH2, kH2K13, KV6.1, MGC12878, potassium channel KH2, potassium channel Kv6.1, potassium voltage-gated channel subfamily G member 1, potassium voltage-gated channel, subfamily G, member 1, Voltage-gated potassium channel subunit Kv6.1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit