Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kv9.1 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen Kv9.1
Dilution Western Blot 1:1000
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18006420
View Documents
Novus Biologicals
NBP18006420UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
NBP180064
View Documents
Novus Biologicals
NBP180064
100 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

Kv9.1 Polyclonal antibody specifically detects Antigen in Human, Primate samples. It is validated for Western Blotting.
Specifications

Specifications

Kv9.1
Western Blot
Unconjugated
RUO
potassium voltage-gated channel subfamily S member 1, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1
KCNS1
IgG
Affinity Purified
58 kDa
Western Blot 1:1000
Polyclonal
Rabbit
NP_002242
3787
Synthetic peptide directed towards the N terminal of human KCNS1. Peptide Sequence: LCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit