Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv9.1 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | Kv9.1 |
|---|---|
| Dilution | Western Blot 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18006420
|
Novus Biologicals
NBP18006420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
NBP180064
|
Novus Biologicals
NBP180064 |
100 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Kv9.1 Polyclonal antibody specifically detects Antigen in Human, Primate samples. It is validated for Western Blotting.Specifications
| Kv9.1 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| potassium voltage-gated channel subfamily S member 1, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1 | |
| KCNS1 | |
| IgG | |
| Affinity Purified | |
| 58 kDa |
| Western Blot 1:1000 | |
| Polyclonal | |
| Rabbit | |
| NP_002242 | |
| 3787 | |
| Synthetic peptide directed towards the N terminal of human KCNS1. Peptide Sequence: LCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title