Kv9.3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB419052	Novus Biologicals NBP18133425UL	25ul
NBP181334	Novus Biologicals NBP181334	0.1 mL

Description

Kv9.3 Polyclonal specifically detects Kv9.3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kv9.3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 3790
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: delayed-rectifier K(+) channel alpha subunit 3, KV9.3, MGC9481, potassium voltage-gated channel subfamily S member 3, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3, Shab-related delayed-rectifier K+ channel alpha subunit 3, voltage-gated potassium channel protein Kv9.3, voltage-gated potassium channel subunit Kv9.3
• Gene Symbols: KCNS3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only