Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KvBeta2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180271

 View more versions of this product

Catalog No. NBP180271


Add to cart

Description

Description

KvBeta2 Polyclonal antibody specifically detects KvBeta2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

KvBeta2
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
KCNAB2
Synthetic peptide directed towards the middle region of human KCNAB2. Peptide sequence: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_003627
HKvbeta2, HKvbeta2.1, HKvbeta2.2, K(+) channel subunit beta-2, K+ channel beta-2 subunit, KCNA2BAKR6A5, KCNK2, KV-BETA-2, MGC117289, potassium channel shaker chain beta 2, potassium voltage-gated channel, shaker-related subfamily, beta member 2, voltage-gated potassium channel subunit beta-2
Rabbit
IgG
100 ul
Signal Transduction
Primary
8514
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit