Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LACC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179523

 View more versions of this product

Catalog No. NBP179523

Add to cart



LACC1 Polyclonal antibody specifically detects LACC1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE.
47 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
This product recognizes Human, mouse Predicted Homology Based On Immunogen Sequence: Bovine: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:1000
chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit