Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LACC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17952320UL
Description
LACC1 Polyclonal specifically detects LACC1 in Mouse samples. It is validated for Western Blot, Immunoprecipitation.Specifications
LACC1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_766076 | |
LACC1 | |
The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE. | |
Affinity Purified | |
RUO | |
144811 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811 | |
Rabbit | |
47 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction