Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Lactate Dehydrogenase C Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154798

 View more versions of this product

Catalog No. NBP154798

Add to cart



Lactate Dehydrogenase C Polyclonal antibody specifically detects Lactate Dehydrogenase C in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish samples. It is validated for Western Blot.


Lactate Dehydrogenase C
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
36 kDa
100 ul
Cellular Markers
Bovine, Canine, Equine, Goat, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Cancer/testis antigen 32, CT32EC, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit