Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lamin B Receptor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | Lamin B Receptor |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15984520
|
Novus Biologicals
NBP15984520UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP159845
|
Novus Biologicals
NBP159845 |
100 μL |
Each for $482.50
|
|
|||||
Description
Lamin B Receptor Polyclonal specifically detects Lamin B Receptor in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| Lamin B Receptor | |
| Unconjugated | |
| RUO | |
| DHCR14B, FLJ43126, Integral nuclear envelope inner membrane protein, lamin B receptor, lamin-B receptor, LMN2R, MGC9041, PHA | |
| LBR | |
| IgG | |
| 71 kDa |
| Polyclonal | |
| Rabbit | |
| Q14739 | |
| 3930 | |
| Synthetic peptides corresponding to LBR (lamin B receptor) The peptide sequence was selected from the middle region of LBR)(50ug). Peptide sequence GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title