Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lano Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309508100UL
Description
Lano Polyclonal specifically detects Lano in Human samples. It is validated for Western Blot.Specifications
Lano | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
dJ523E19.1, FLJ10775, FLJ11834, LANOLANO adapter protein, LAP (leucine-rich repeats and PDZ) and no PDZ protein, LAP and no PDZ protein, leucine rich repeat containing 1, leucine-rich repeat-containing 1, leucine-rich repeat-containing protein 1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lano. Peptide sequence RAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRND | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
55227 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction