Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LAP3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179642

 View more versions of this product

Catalog No. NBP179642


Add to cart

Description

Description

LAP3 Polyclonal antibody specifically detects LAP3 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

LAP3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
LAP3
Synthetic peptide directed towards the N terminal of human Lap3The immunogen for this antibody is Lap3. Peptide sequence QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD.
57 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Guinea pig: 86%; Zebrafish: 79% Xenopus: 78%; chicken 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:1000
NP_077754
EC 3.4.11, EC 3.4.11.5, LAP, LAPEPEC 3.4.11.1, leucine aminopeptidase 3Prolyl aminopeptidase, Leucyl aminopeptidase, PEPScytosol aminopeptidase, Peptidase SLAP-3, Proline aminopeptidase
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
51056
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit