Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARGE Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | LARGE |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159946
|
Novus Biologicals
NBP159946 |
100 μL |
Each of 1 for $436.00
|
|
Description
LARGE Polyclonal specifically detects LARGE in Human samples. It is validated for Western Blot.Specifications
LARGE | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Acetylglucosaminyltransferase-like 1A, EC 2.4, glycosyltransferase-like protein LARGE1, KIAA0609acetylglucosaminyltransferase-like protein, LARGE1, like-acetylglucosaminyltransferase, like-glycosyltransferase, MDC1D, MDDGA6, MDDGB6 | |
LARGE | |
IgG | |
Affinity Purified | |
88 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O95461 | |
9215 | |
Synthetic peptides corresponding to LARGE(like-glycosyltransferase) The peptide sequence was selected from the middle region of LARGE (NP_004728). Peptide sequence AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title