Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LARP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18047220UL

 View more versions of this product

Catalog No. NBP18047220


Add to cart

Description

Description

LARP4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

LARP4
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
LARP4
Synthetic peptide directed towards the middle region of human LARP4. Peptide sequence VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ.
Immunogen affinity purified
RUO
Primary
113251
Western Blot
Western Blot 1:1000
NP_954660
c-Mpl binding protein, DKFZp686E039, La ribonucleoprotein domain family member 4, La ribonucleoprotein domain family, member 4, la-related protein 4, MGC74631, PP13296
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit