Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

LARP5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen LARP5
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125982
View Documents
Novus Biologicals
NBP31054025UL
25 μg
Each for $106.19
N/A
NB125981
View Documents
Novus Biologicals
NBP310540100UL
100 μg
Each for $352.89
N/A
Description

Description

LARP5 Polyclonal antibody specifically detects LARP5 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

LARP5
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
23185
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
KIAA0217DKFZp686M23113, La ribonucleoprotein domain family member 4B, La ribonucleoprotein domain family member 5, La ribonucleoprotein domain family, member 4B, La ribonucleoprotein domain family, member 5, la-related protein 4B, La-related protein 5, LARP5
The immunogen is a synthetic peptide directed towards the middle region of Mouse LARP5 (NP_766173). Peptide sequence ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit