Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LCN6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$165.00 - $436.00

Specifications

Antigen LCN6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15795720
View Documents
Novus Biologicals
NBP15795720UL
20 μL
Each for $165.00
Add to cart
 
NBP157957
View Documents
Novus Biologicals
NBP157957
100 μL
Each for $436.00
Add to cart
 
Description

Description

LCN6 Polyclonal specifically detects LCN6 in Human samples. It is validated for Western Blot.
Specifications

Specifications

LCN6
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
epididymal-specific lipocalin LCN6, epididymal-specific lipocalin-6, hLcn5, LCN5, lipocalin 5, lipocalin 6, lipocalin-5, UNQ643
LCN6
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
P62502
158062
Synthetic peptides corresponding to LCN6(lipocalin 6) The peptide sequence was selected from the middle region of LCN6. Peptide sequence LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit