Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCN6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$165.00 - $436.00
Specifications
| Antigen | LCN6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15795720
|
Novus Biologicals
NBP15795720UL |
20 μL |
Each for $165.00
|
|
NBP157957
|
Novus Biologicals
NBP157957 |
100 μL |
Each for $436.00
|
|
Description
LCN6 Polyclonal specifically detects LCN6 in Human samples. It is validated for Western Blot.Specifications
| LCN6 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| epididymal-specific lipocalin LCN6, epididymal-specific lipocalin-6, hLcn5, LCN5, lipocalin 5, lipocalin 6, lipocalin-5, UNQ643 | |
| LCN6 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P62502 | |
| 158062 | |
| Synthetic peptides corresponding to LCN6(lipocalin 6) The peptide sequence was selected from the middle region of LCN6. Peptide sequence LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title