Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCN8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | LCN8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156314
|
Novus Biologicals
NBP156314 |
100 μL |
Each of 1 for $436.00
|
|
Description
LCN8 Polyclonal specifically detects LCN8 in Human samples. It is validated for Western Blot.Specifications
LCN8 | |
Polyclonal | |
Rabbit | |
Human | |
A1L4A8 | |
138307 | |
Synthetic peptides corresponding to LCN8(lipocalin 8) The peptide sequence was selected from the N terminal of LCN8. Peptide sequence EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 9 open reading frame 137, EP17, epididymal-specific lipocalin-8, LCN5, lipocalin 5, lipocalin 8 | |
LCN8 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title