Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LDB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP154998
Description
LDB3 Polyclonal specifically detects LDB3 in Human, Mouse samples. It is validated for Western Blot.Specifications
LDB3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CMD1C, CYPHER, KIAA01613, KIAA0613FLJ35865, LDB3Z1, LDB3Z4, LIM domain binding 3, LIM domain-binding protein 3, ORACLE, PDLIM6, PDZ and LIM domain 6, Protein cypher, ZASPLVNC3, Z-band alternatively spliced PDZ-motif protein | |
Rabbit | |
36 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
O75112-5 | |
LDB3 | |
Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS. | |
Protein A purified | |
RUO | |
11155 | |
Human, Mouse, Rat, Bovine, Guinea Pig | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction