Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LDB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$152.22 - $436.00

Specifications

Antigen LDB3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15499820
View Documents
Novus Biologicals
NBP15499820UL
20 μL
Each for $152.22
Add to cart
 
NBP154998
View Documents
Novus Biologicals
NBP154998
100 μL
Each for $436.00
Add to cart
 
Description

Description

LDB3 Polyclonal specifically detects LDB3 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

LDB3
Polyclonal
Purified
RUO
O75112-5
11155
Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CMD1C, CYPHER, KIAA01613, KIAA0613FLJ35865, LDB3Z1, LDB3Z4, LIM domain binding 3, LIM domain-binding protein 3, ORACLE, PDLIM6, PDZ and LIM domain 6, Protein cypher, ZASPLVNC3, Z-band alternatively spliced PDZ-motif protein
LDB3
IgG
Protein A purified
36 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit