Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LDHAL6B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen LDHAL6B
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125088
View Documents
Novus Biologicals
NBP31009325UL
25 μg
Each for $106.19
Add to cart
 
NB125087
View Documents
Novus Biologicals
NBP310093100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

LDHAL6B Polyclonal antibody specifically detects LDHAL6B in Human samples. It is validated for Western Blot
Specifications

Specifications

LDHAL6B
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
92483
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B
The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B (NP_149972.1). Peptide sequence LKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWAIGLSVADLT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit