LDHAL6B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155494

Catalog No. NBP155494

Description

LDHAL6B Polyclonal specifically detects LDHAL6B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: LDHAL6B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BYZ2
• Gene Symbols: LDHAL6B
• Immunogen: Synthetic peptides corresponding to LDHAL6B(lactate dehydrogenase A-like 6B) The peptide sequence was selected from the middle region of LDHAL6B. Peptide sequence SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 92483
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Bovine 79%, Porcine 79%.
• Target Species: Human, Rat, Porcine, Bovine, Rabbit
• Isotype: IgG