Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LDHAL6B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15549420UL
Description
LDHAL6B Polyclonal specifically detects LDHAL6B in Human samples. It is validated for Western Blot.Specifications
LDHAL6B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9BYZ2 | |
LDHAL6B | |
Synthetic peptides corresponding to LDHAL6B(lactate dehydrogenase A-like 6B) The peptide sequence was selected from the middle region of LDHAL6B. Peptide sequence SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA. | |
Affinity Purified | |
RUO | |
92483 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 1.1.1, lactate dehydrogenase A-like 6, lactate dehydrogenase A-like 6B, LDH6B, LDHAL6, LDHLEC 1.1.1.27, L-lactate dehydrogenase A-like 6B | |
Rabbit | |
42 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title